Compact :
kompakti
sopimus, liitto, kompakti
kompakti, tiheä, paksu, käsittämätön, lyhyt, yhteenveto, suppea, yritys, vahva, jäykkä, vankka, tiukka, kiinni, ytimekäs, istuva, integroitu, tungosta, jatkuva, lakkaamaton, jakamaton, yhdistää, hellittämätön, kiistaton, vapaa reiät, tiheäkudoksisia, tukkoinen, kokoonpanossa, täsmällinen, koko, ikäinen
kompaktitiivistettycompactercompactesttiivistystiivistyminenkompaktistitiiviyttäcompactorpuristimettiivistetäänsubcompactsubcompacts
kompaktitiivistettycompactercompactesttiivistystiivistyminenkompaktistitiiviyttäcompactorpuristimettiivistetäänsubcompactsubcompacts
Noun(1) a small cosmetics case with a mirror; to be carried in a woman's purse(2) a signed written agreement between two or more parties (nations(3) a small and economical car
Verb(1) have the property of being packable or of compacting easily(2) compress into a wad(3) make more compact by or as if by pressing(4) squeeze or press together
Adjective(1) closely and firmly united or packed together(2) having a short and solid form or stature(3) briefly giving the gist of something
(1) Samantha and Todd share a compact space that provides a chair and computer station for each of them at a gracefully curved, solid cherry desk.(2) It was rather a ├ö├ç├┐federal├ö├ç├û approach, a compact between indigenous lords and their nominal superiors.(3) It is true that the Paris region area is denser and more compact than are common world cities (such as London).(4) It's also compact enough to tuck neatly into an entertainment center or tabletop without being too obtrusive.(5) Its texture ranges from dense porcelain-like to a compact granular material composed of minute crystals.(6) Overall the sheltie is a compact dog with a moderately long head, the tiniest of ears and an expression of wisdom and kindness.(7) Dark colors are dramatic but will make a compact space seem smaller.(8) We were standing outside the Monitor's office in the harsh afternoon sun and now Short, a compact woman with a ruddy complexion, took a drag on her cigarette.(9) Be assured, this latest XJ is compact enough to fit into a normal-size garage, and can easily cope with the tight spaces of multi-storey car parks.(10) He's compact and sturdy yet runs like a sprinter.(11) Some evidence indicates that the traction exerted during cell locomotion can concomitantly compact the surrounding network.(12) Excellent marksmanship is one of the key skills required of the marshals, who work in very compact spaces often tens of thousands of feet in the air.(13) Its tiny, bell-shaped, cobalt-blue flowers, each with a very delicate white border, form a compact cluster.(14) His counterpart was a short, compact man, obviously in the type of shape and trim that came from self-indulgent working out.(15) The protein units appear to be packed in a compact hexagonal way and from the position and distribution of the spots it is possible to derive some structural parameters.(16) VerÔö£┬«d CosmetiquÔö£┬«'s bronzing powder is encased in a beautiful silver compact with a mirror and separate compartment for the brush applicator.
Related Phrases of compact(1) compact disc ::
CD-levy(2) compact disk ::
CD-levy(3) compact car ::
kompakti auto(4) compact bone ::
tiivis luu(5) compact flash ::
compact flash(6) powder compact ::
jauhe kompakti
(1) compact disc ::
CD-levy(2) compact disk ::
CD-levy(3) compact car ::
kompakti auto(4) compact bone ::
tiivis luu(5) compact flash ::
compact flash(6) powder compact ::
jauhe kompakti
Synonyms
Adjective
1. dense ::
tiheä
2. small ::
pieni
3. concise ::
suppea
4. thickset ::
vanttera
5. compendious ::
suppea
Noun
6. treaty ::
sopimus
7. covenant ::
liitto
8. compact car ::
kompakti auto
9. powder compact ::
jauhe kompakti
Verb
10. compress ::
puristaa
11. pack together ::
pack yhdessä
12. pack ::
pakkaus
13. squeeze ::
puristaa
14. wad ::
pulla
Adjective
1. dense ::
tiheä
2. small ::
pieni
3. concise ::
suppea
4. thickset ::
vanttera
5. compendious ::
suppea
Noun
6. treaty ::
sopimus
7. covenant ::
liitto
8. compact car ::
kompakti auto
9. powder compact ::
jauhe kompakti
Verb
10. compress ::
puristaa
11. pack together ::
pack yhdessä
12. pack ::
pakkaus
13. squeeze ::
puristaa
14. wad ::
pulla
Antonyms
1. flabby ::
vetelä
2. soft ::
pehmeä
1. flabby ::
vetelä
2. soft ::
pehmeä
Different Formscompact, compacted, compacter, compactest, compacting, compaction, compactly, compactness, compactor, compactors, compacts, subcompact, subcompacts
Word Example from TV Showsyou best go with
something more COMPACT.
Breaking Bad Season 4, Episode 2
you best go with
something more COMPACT.
Breaking Bad Season 4, Episode 2
English to Finnish Dictionary: compact
Meaning and definitions of compact, translation in Finnish
language for compact with similar and opposite words. Also find spoken pronunciation of compact in Finnish and in English language.
Tags for the entry 'compact'
What compact means in Finnish, compact meaning
in Finnish, compact
definition, examples and pronunciation
of compact in Finnish language.
Meaning and definitions of compact, translation in Finnish
language for compact with similar and opposite words. Also find spoken pronunciation of compact in Finnish and in English language.
What compact means in Finnish, compact meaning
in Finnish, compact
definition, examples and pronunciation
of compact in Finnish language.